GSDMDC1 Antibody
产品特性
| Product Cat#: | NBP2-33422 |
| Product type: | Primary antibody |
| Antigen: | GSDMDC1 |
| Immunogen: | This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS |
| Species immunized: | Rabbit |
| Isotype: | IgG |
| Applications: | WB, ICC/IF, IHC, IP, KD, KO |
| Reactivity: | Hu, Mu, Rt, Po |
| Clonality (clone number): | Polyclonal |
| Form: | Liquid |
| Buffer: | PBS (pH 7.2), 40% Glycerol, 0.02% Sodium Azide |
| Concentration: | - mg/mL |
| Purity: | Immunogen affinity purified |
| Storage: | Aliquot and freeze at -20℃. Avoid multiple freeze/thaw cycles. |
| Alternative names: | DF5L |
| DFNA5L | |
| FKSG10 | |
| FLJ12150 | |
| gasdermin D | |
| gasdermin domain containing 1 | |
| Gasdermin domain-containing protein 1 | |
| gasdermin-D | |
| GSDMD N | |
| GSDMD | |
| GSDMDC1 | |
| GSDMD-N | |
| hGSDMD-CTD |
靶标信息
Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation ofepithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively splicedtranscript variants have been described. (provided by RefSeq)
相关文献
1、Yang, Y., Yu, Q., Li, B., Yang, Z., Zhang, S., & Yuan, F. (2023). Palmitate lipotoxicity is closely associated with the fatty acid-albumin complexes in BV-2 microglia. PloS one, 18(4), e0281189. https://doi.org/10.1371/journal.pone.0281189
2、Exconde, P. M., Hernandez-Chavez, C., Bray, M. B., Lopez, J. L., Srivastava, T., Egan, M. S., Zhang, J., Shin, S., Discher, B. M., & Taabazuing, C. Y. (2023). The tetrapeptide sequence of IL-1β regulates its recruitment and activation by inflammatory caspases. bioRxiv : the preprint server for biology, 2023.02.16.528859. https://doi.org/10.1101/2023.02.16.528859
3、Wang, Y., Pei, S., Liu, Z., Ding, Y., Qian, T., Wen, H., Hsu, S. W., Zhou, Z., Zhang, J., & Wang, H. (2023). IRAK-M suppresses the activation of microglial NLRP3 inflammasome and GSDMD-mediated pyroptosis through inhibiting IRAK1 phosphorylation during experimental autoimmune encephalomyelitis. Cell death & disease, 14(2), 103. https://doi.org/10.1038/s41419-023-05621-6
4、Hu, R., Liang, J., Ding, L., Zhang, W., Wang, Y., Zhang, Y., Zhang, D., Pei, L., Liu, X., Xia, Z., Xu, Y., & Song, B. (2023). Gasdermin D inhibition ameliorates neutrophil mediated brain damage in acute ischemic stroke. Cell death discovery, 9(1), 50. https://doi.org/10.1038/s41420-023-01349-6
